PRSS16 polyclonal antibody
  • PRSS16 polyclonal antibody

PRSS16 polyclonal antibody

Ref: AB-PAB20961
PRSS16 polyclonal antibody

Información del producto

Rabbit polyclonal antibody raised against recombinant PRSS16.
Información adicional
Size 100 uL
Gene Name PRSS16
Gene Alias FLJ36271|FLJ40714|FLJ44172|TSSP
Gene Description protease, serine, 16 (thymus)
Storage Conditions Store at 4C. For long term storage store at -20C.
Aliquot to avoid repeated freezing and thawing.
Application Key IHC-P
Immunogen Prot. Seq HSTPYCGLRRAVQIVLHSLGQKCLSFSRAETVAQLRSTEPQLSGVGDRQWLYQTCTEFGFYVTCENPRCPFSQLPALPSQLDLCEQVFGLSALSVAQAVAQTNSYYGG
Form Liquid
Recomended Dilution Immunohistochemistry (1:50-1:200)
The optimal working dilution should be determined by the end user.
Antigen species Target species Human
Immunogen Recombinant protein corresponding to amino acids of human PRSS16.
Storage Buffer In PBS, pH 7.2 (40% glycerol, 0.02% sodium azide)
Gene ID 10279
Iso type IgG

Enviar un mensaje


PRSS16 polyclonal antibody

PRSS16 polyclonal antibody