SGEF polyclonal antibody
  • SGEF polyclonal antibody

SGEF polyclonal antibody

Ref: AB-PAB20956
SGEF polyclonal antibody

Información del producto

Rabbit polyclonal antibody raised against recombinant SGEF.
Información adicional
Size 100 uL
Gene Name SGEF
Gene Alias CSGEF|DKFZp434D146|HMFN1864
Gene Description Src homology 3 domain-containing guanine nucleotide exchange factor
Storage Conditions Store at 4C. For long term storage store at -20C.
Aliquot to avoid repeated freezing and thawing.
Application Key WB,IHC-P
Immunogen Prot. Seq PEEDLTGLTASPVPSPTANGLAANNDSPGSGSQSGRKAKDPERGLFPGPQKSSSEQKLPLQRLPSQENELLENPSVVLSTNSPAALKVGKQQIIPKSLASEIKISKSNNQNV
Form Liquid
Recomended Dilution Western Blot (1:250-1:500)
The optimal working dilution should be determined by the end user.
Antigen species Target species Human
Immunogen Recombinant protein corresponding to amino acids of human SGEF.
Storage Buffer In PBS, pH 7.2 (40% glycerol, 0.02% sodium azide)
Gene ID 26084
Iso type IgG

Enviar un mensaje


SGEF polyclonal antibody

SGEF polyclonal antibody