DOCK5 polyclonal antibody
  • DOCK5 polyclonal antibody

DOCK5 polyclonal antibody

Ref: AB-PAB20955
DOCK5 polyclonal antibody

Información del producto

Rabbit polyclonal antibody raised against recombinant DOCK5.
Información adicional
Size 100 uL
Gene Name DOCK5
Gene Alias DKFZp451J181|DKFZp779M164|DKFZp781J211
Gene Description dedicator of cytokinesis 5
Storage Conditions Store at 4C. For long term storage store at -20C.
Aliquot to avoid repeated freezing and thawing.
Application Key IF
Immunogen Prot. Seq VELSVLFCKFIQSIPDNQLVRQKLNCMTKIVESTLFRQSECREVLLPLLTDQLSGQLDDNSNKPDHEASSQLL
Form Liquid
Recomended Dilution Immunofluorescence (0.25-2 ug/mL)
The optimal working dilution should be determined by the end user.
Antigen species Target species Human
Immunogen Recombinant protein corresponding to amino acids of human DOCK5.
Storage Buffer In PBS, pH 7.2 (40% glycerol, 0.02% sodium azide)
Gene ID 80005
Iso type IgG

Enviar un mensaje


DOCK5 polyclonal antibody

DOCK5 polyclonal antibody