DNAJC14 polyclonal antibody
  • DNAJC14 polyclonal antibody

DNAJC14 polyclonal antibody

Ref: AB-PAB20951
DNAJC14 polyclonal antibody

Información del producto

Rabbit polyclonal antibody raised against recombinant DNAJC14.
Información adicional
Size 100 uL
Gene Name DNAJC14
Gene Alias DNAJ|DRIP78|HDJ3|LIP6
Gene Description DnaJ (Hsp40) homolog, subfamily C, member 14
Storage Conditions Store at 4C. For long term storage store at -20C.
Aliquot to avoid repeated freezing and thawing.
Application Key WB-Ce,WB,IHC-P,IF
Immunogen Prot. Seq WGWLELPWVKQNINRQGNAPVASGRYCQPEEEVARLLTMAGVPEDELNPFHVLGVEATASDVELKKAYRQLAVMVHPDKNHHPRAEEAFKVLRAAWDIVSNAEKRKEYEMKRMAENELSRSVNEFLSKLQDDLKEAMNTMMCSRCQG
Form Liquid
Recomended Dilution Immunohistochemistry (1:200-1:500)
Western Blot (1:250-1:500)
The optimal working dilution should be determined by the end user.
Antigen species Target species Human
Immunogen Recombinant protein corresponding to amino acids of human DNAJC14.
Storage Buffer In PBS, pH 7.2 (40% glycerol, 0.02% sodium azide)
Gene ID 85406
Iso type IgG

Enviar un mensaje


DNAJC14 polyclonal antibody

DNAJC14 polyclonal antibody