GALNAC4S-6ST polyclonal antibody
  • GALNAC4S-6ST polyclonal antibody

GALNAC4S-6ST polyclonal antibody

Ref: AB-PAB20946
GALNAC4S-6ST polyclonal antibody

Información del producto

Rabbit polyclonal antibody raised against recombinant GALNAC4S-6ST.
Información adicional
Size 100 uL
Gene Name GALNAC4S-6ST
Gene Alias BRAG|DKFZp781H1369|KIAA0598|MGC34346|RP11-47G11.1
Gene Description B cell RAG associated protein
Storage Conditions Store at 4C. For long term storage store at -20C.
Aliquot to avoid repeated freezing and thawing.
Application Key IHC-P
Immunogen Prot. Seq GIVRLRDGLRDRYPVEDYLDLFDLAAHQIHQGLQASSAKEQSKMNTIIIGEASASTMWDNNAWTFFYDNSTDGEPPFLTQDFIHAFQPNARLIVMLRDPVER
Form Liquid
Recomended Dilution Immunohistochemistry (1:50-1:200)
The optimal working dilution should be determined by the end user.
Antigen species Target species Human
Immunogen Recombinant protein corresponding to amino acids of human GALNAC4S-6ST.
Storage Buffer In PBS, pH 7.2 (40% glycerol, 0.02% sodium azide)
Gene ID 51363
Iso type IgG

Enviar un mensaje


GALNAC4S-6ST polyclonal antibody

GALNAC4S-6ST polyclonal antibody