KCNJ5 polyclonal antibody
  • KCNJ5 polyclonal antibody

KCNJ5 polyclonal antibody

Ref: AB-PAB20944
KCNJ5 polyclonal antibody

Información del producto

Rabbit polyclonal antibody raised against recombinant KCNJ5.
Información adicional
Size 100 uL
Gene Name KCNJ5
Gene Alias CIR|GIRK4|KATP1|KIR3.4
Gene Description potassium inwardly-rectifying channel, subfamily J, member 5
Storage Conditions Store at 4C. For long term storage store at -20C.
Aliquot to avoid repeated freezing and thawing.
Application Key WB-Tr,IHC-P
Immunogen Prot. Seq VTPWDPKKIPKQARDYVPIATDRTRLLAEGKKPRQRYMEKSGKCNVHHGNVQETY
Form Liquid
Recomended Dilution Immunohistochemistry (1:50-1:200)
Western Blot (1:250-1:500)
The optimal working dilution should be determined by the end user.
Antigen species Target species Human
Immunogen Recombinant protein corresponding to amino acids of human KCNJ5.
Storage Buffer In PBS, pH 7.2 (40% glycerol, 0.02% sodium azide)
Gene ID 3762
Iso type IgG

Enviar un mensaje


KCNJ5 polyclonal antibody

KCNJ5 polyclonal antibody