ZFPL1 polyclonal antibody
  • ZFPL1 polyclonal antibody

ZFPL1 polyclonal antibody

Ref: AB-PAB20943
ZFPL1 polyclonal antibody

Información del producto

Rabbit polyclonal antibody raised against recombinant ZFPL1.
Información adicional
Size 100 uL
Gene Name ZFPL1
Gene Alias D11S750|MCG4
Gene Description zinc finger protein-like 1
Storage Conditions Store at 4C. For long term storage store at -20C.
Aliquot to avoid repeated freezing and thawing.
Application Key IHC-P,IF
Immunogen Prot. Seq KCPKRKVTNLFCFEHRVNVCEHCLVANHAKCIVQSYLQWLQDSDYNPNCRLCNIPLASRETTRLVCYDLFHWACLNERAAQLPRNTAPAGYQCPSCNGPIFPPTNLAG
Form Liquid
Recomended Dilution Immunohistochemistry (1:50-1:200)
Immunofluorescence (1-4 ug/mL)
The optimal working dilution should be determined by the end user.
Antigen species Target species Human
Immunogen Recombinant protein corresponding to amino acids of human ZFPL1.
Storage Buffer In PBS, pH 7.2 (40% glycerol, 0.02% sodium azide)
Gene ID 7542
Iso type IgG

Enviar un mensaje


ZFPL1 polyclonal antibody

ZFPL1 polyclonal antibody