LEMD2 polyclonal antibody
  • LEMD2 polyclonal antibody

LEMD2 polyclonal antibody

Ref: AB-PAB20940
LEMD2 polyclonal antibody

Información del producto

Rabbit polyclonal antibody raised against recombinant LEMD2.
Información adicional
Size 100 uL
Gene Name LEMD2
Gene Alias dJ482C21.1
Gene Description LEM domain containing 2
Storage Conditions Store at 4C. For long term storage store at -20C.
Aliquot to avoid repeated freezing and thawing.
Application Key IHC-P,IF
Immunogen Prot. Seq EDNMKLLPVDCERKTDEFCQAKQKAALLELLHELYNFLAIQAGNFECGNPENLKSKCIPVMEAQEYIANVTSSSSAKFEAALTWILSSNKDVGIWLKGEDQSELVTTVDKVVCLESAHP
Form Liquid
Recomended Dilution Immunohistochemistry (1:10-1:20)
Immunofluorescence (1-4 ug/mL)
The optimal working dilution should be determined by the end user.
Antigen species Target species Human
Immunogen Recombinant protein corresponding to amino acids of human LEMD2.
Storage Buffer In PBS, pH 7.2 (40% glycerol, 0.02% sodium azide)
Gene ID 221496
Iso type IgG

Enviar un mensaje


LEMD2 polyclonal antibody

LEMD2 polyclonal antibody