FAR1 polyclonal antibody
  • FAR1 polyclonal antibody

FAR1 polyclonal antibody

Ref: AB-PAB20937
FAR1 polyclonal antibody

Información del producto

Rabbit polyclonal antibody raised against recombinant FAR1.
Información adicional
Size 100 uL
Gene Name FAR1
Gene Alias DKFZp686A0370|DKFZp686P18247|FLJ22728|FLJ33561|MLSTD2|SDR10E1
Gene Description fatty acyl CoA reductase 1
Storage Conditions Store at 4C. For long term storage store at -20C.
Aliquot to avoid repeated freezing and thawing.
Application Key WB,IHC-P
Immunogen Prot. Seq YYEGKNVLLTGATGFLGKVLLEKLLRSCPKVNSVYVLVRQKAGQTPQERVEEVLSGKLFDRLRDENPDFREKIIAINSELTQPKLALSEEDKEVIIDSTNIIFHCAATVRFNENLRDAVQLNVIATRQLILLAQQMKNLEVFM
Form Liquid
Recomended Dilution Immunohistochemistry (1:10-1:20)
Western Blot (1:250-1:500)
The optimal working dilution should be determined by the end user.
Antigen species Target species Human
Immunogen Recombinant protein corresponding to amino acids of human FAR1.
Storage Buffer In PBS, pH 7.2 (40% glycerol, 0.02% sodium azide)
Gene ID 84188
Iso type IgG

Enviar un mensaje


FAR1 polyclonal antibody

FAR1 polyclonal antibody