CACHD1 polyclonal antibody
  • CACHD1 polyclonal antibody

CACHD1 polyclonal antibody

Ref: AB-PAB20925
CACHD1 polyclonal antibody

Información del producto

Rabbit polyclonal antibody raised against recombinant CACHD1.
Información adicional
Size 100 uL
Gene Name CACHD1
Gene Alias KIAA1573|RP4-655E10.1
Gene Description cache domain containing 1
Storage Conditions Store at 4C. For long term storage store at -20C.
Aliquot to avoid repeated freezing and thawing.
Application Key IHC-P
Immunogen Prot. Seq SLPFSDEMGDGLIMTVSKPCYFGNLLLGIVGVDVNLAYILEDVTYYQDSLASYTFLIDDKGYTLMHPSLTRPYLLSEPPLHTDIIHYENIPKFELVRQNILSLPLGSQIIAVPVNSSLSWHINKLRETGKEA
Form Liquid
Recomended Dilution Immunohistochemistry (1:1000-1:2500)
The optimal working dilution should be determined by the end user.
Antigen species Target species Human
Immunogen Recombinant protein corresponding to amino acids of human CACHD1.
Storage Buffer In PBS, pH 7.2 (40% glycerol, 0.02% sodium azide)
Gene ID 57685
Iso type IgG

Enviar un mensaje


CACHD1 polyclonal antibody

CACHD1 polyclonal antibody