GALNTL2 polyclonal antibody
  • GALNTL2 polyclonal antibody

GALNTL2 polyclonal antibody

Ref: AB-PAB20921
GALNTL2 polyclonal antibody

Información del producto

Rabbit polyclonal antibody raised against recombinant GALNTL2.
Información adicional
Size 100 uL
Gene Name GALNTL2
Gene Alias DKFZp686H1113|GALNT13|GALNT15|GALNT7|PIH5
Gene Description UDP-N-acetyl-alpha-D-galactosamine:polypeptide N-acetylgalactosaminyltransferase-like 2
Storage Conditions Store at 4C. For long term storage store at -20C.
Aliquot to avoid repeated freezing and thawing.
Application Key IHC-P
Immunogen Prot. Seq GGSVEILPCSRVGHIYQNQDSHSPLDQEATLRNRVRIAETWLGSFKETFYKHSPEAFSLSKAEKPDCMERLQLQRRLGCRTFHWFLANVYPELYPSEPRPSFSGKLHNTGLG
Form Liquid
Recomended Dilution Immunohistochemistry (1:50-1:200)
The optimal working dilution should be determined by the end user.
Antigen species Target species Human
Immunogen Recombinant protein corresponding to amino acids of human GALNTL2.
Storage Buffer In PBS, pH 7.2 (40% glycerol, 0.02% sodium azide)
Gene ID 117248
Iso type IgG

Enviar un mensaje


GALNTL2 polyclonal antibody

GALNTL2 polyclonal antibody