CCDC104 polyclonal antibody
  • CCDC104 polyclonal antibody

CCDC104 polyclonal antibody

Ref: AB-PAB20918
CCDC104 polyclonal antibody

Información del producto

Rabbit polyclonal antibody raised against recombinant CCDC104.
Información adicional
Size 100 uL
Gene Name CCDC104
Gene Alias MGC15407
Gene Description coiled-coil domain containing 104
Storage Conditions Store at 4C. For long term storage store at -20C.
Aliquot to avoid repeated freezing and thawing.
Application Key WB,IHC-P
Immunogen Prot. Seq DEEESKLTYTEIHQEYKELVEKLLEGYLKEIGINEDQFQEACTSPLAKTHTSQAILQPVLAAEDFTIFKAMMVQKNIEMQLQAIRIIQERNGVLPDCLTDGSDVVSDLEHEEMKILREVLRKSKEEYDQEEERKRK
Form Liquid
Recomended Dilution Immunohistochemistry (1:200-1:500)
Western Blot (1:250-1:500)
The optimal working dilution should be determined by the end user.
Antigen species Target species Human
Immunogen Recombinant protein corresponding to amino acids of human CCDC104.
Storage Buffer In PBS, pH 7.2 (40% glycerol, 0.02% sodium azide)
Gene ID 112942
Iso type IgG

Enviar un mensaje


CCDC104 polyclonal antibody

CCDC104 polyclonal antibody