USP30 polyclonal antibody
  • USP30 polyclonal antibody

USP30 polyclonal antibody

Ref: AB-PAB20915
USP30 polyclonal antibody

Información del producto

Rabbit polyclonal antibody raised against recombinant USP30.
Información adicional
Size 100 uL
Gene Name USP30
Gene Alias FLJ40511|MGC10702
Gene Description ubiquitin specific peptidase 30
Storage Conditions Store at 4C. For long term storage store at -20C.
Aliquot to avoid repeated freezing and thawing.
Application Key WB-Tr,IHC-P
Immunogen Prot. Seq IEAKGTLNGEKVEHQRTTFVKQLKLGKLPQCLCIHLQRLSWSSHGTPLKRHEHVQFNEFLMMDIYKYHLLGHKPSQHNPKLNKNPGPTLELQDGPGAPTPVLNQPGAPKTQIFMNGACSPSLLPTLSAPMPFPLPVVPDYSSST
Form Liquid
Recomended Dilution Immunohistochemistry (1:50-1:200)
Western Blot (1:250-1:500)
The optimal working dilution should be determined by the end user.
Antigen species Target species Human
Immunogen Recombinant protein corresponding to amino acids of human USP30.
Storage Buffer In PBS, pH 7.2 (40% glycerol, 0.02% sodium azide)
Gene ID 84749
Iso type IgG

Enviar un mensaje


USP30 polyclonal antibody

USP30 polyclonal antibody