C21orf62 polyclonal antibody
  • C21orf62 polyclonal antibody

C21orf62 polyclonal antibody

Ref: AB-PAB20913
C21orf62 polyclonal antibody

Información del producto

Rabbit polyclonal antibody raised against recombinant C21orf62.
Información adicional
Size 100 uL
Gene Name C21orf62
Gene Alias B37|C21orf120|PRED81
Gene Description chromosome 21 open reading frame 62
Storage Conditions Store at 4C. For long term storage store at -20C.
Aliquot to avoid repeated freezing and thawing.
Application Key IHC-P
Immunogen Prot. Seq TLVQDLKLSLCSTNTLPTEYLAICGLKRLRINMEAKHPFPEQSLLIHSGGDSDSREKPMWLHKGWQPCMYISFLD
Form Liquid
Recomended Dilution Immunohistochemistry (1:20-1:50)
The optimal working dilution should be determined by the end user.
Antigen species Target species Human
Immunogen Recombinant protein corresponding to amino acids of human C21orf62.
Storage Buffer In PBS, pH 7.2 (40% glycerol, 0.02% sodium azide)
Gene ID 56245
Iso type IgG

Enviar un mensaje


C21orf62 polyclonal antibody

C21orf62 polyclonal antibody