ZFR polyclonal antibody
  • ZFR polyclonal antibody

ZFR polyclonal antibody

Ref: AB-PAB20896
ZFR polyclonal antibody

Información del producto

Rabbit polyclonal antibody raised against recombinant ZFR.
Información adicional
Size 100 uL
Gene Name ZFR
Gene Alias FLJ41312|ZFR1
Gene Description zinc finger RNA binding protein
Storage Conditions Store at 4C. For long term storage store at -20C.
Aliquot to avoid repeated freezing and thawing.
Application Key WB,IHC-P,IF
Immunogen Prot. Seq NCTVNTSSIATSSMKGLTTTGNSSLNSTSNTKVSAVPTNMAAKKTSTPKINFVGGNKLQSTGNKAEDIKGTECVKSTPVTSAVQIPEVKQDTVSEPVTPASLAALQSDVQPV
Form Liquid
Recomended Dilution Immunohistochemistry (1:10-1:20)
Western Blot (1:250-1:500)
Immunofluorescence (1-4 ug/mL)
The optimal working dilution should be determined by the end user.
Antigen species Target species Human
Immunogen Recombinant protein corresponding to amino acids of human ZFR.
Storage Buffer In PBS, pH 7.2 (40% glycerol, 0.02% sodium azide)
Gene ID 51663
Iso type IgG

Enviar un mensaje


ZFR polyclonal antibody

ZFR polyclonal antibody