LINGO2 polyclonal antibody
  • LINGO2 polyclonal antibody

LINGO2 polyclonal antibody

Ref: AB-PAB20894
LINGO2 polyclonal antibody

Información del producto

Rabbit polyclonal antibody raised against recombinant LINGO2.
Información adicional
Size 100 uL
Gene Name LINGO2
Gene Alias FLJ31810|LERN3|LRRN6C
Gene Description leucine rich repeat and Ig domain containing 2
Storage Conditions Store at 4C. For long term storage store at -20C.
Aliquot to avoid repeated freezing and thawing.
Application Key IHC-P
Immunogen Prot. Seq ITTKSNGRATVLGDGTLEIRFAQDQDSGMYVCIASNAAGNDTFTASLTVKGFASDRFLYANRTPMY
Form Liquid
Recomended Dilution Immunohistochemistry (1:50-1:200)
The optimal working dilution should be determined by the end user.
Antigen species Target species Human
Immunogen Recombinant protein corresponding to amino acids of human LINGO2.
Storage Buffer In PBS, pH 7.2 (40% glycerol, 0.02% sodium azide)
Gene ID 158038
Iso type IgG

Enviar un mensaje


LINGO2 polyclonal antibody

LINGO2 polyclonal antibody