TEX261 polyclonal antibody
  • TEX261 polyclonal antibody

TEX261 polyclonal antibody

Ref: AB-PAB20893
TEX261 polyclonal antibody

Información del producto

Rabbit polyclonal antibody raised against recombinant TEX261.
Información adicional
Size 100 uL
Gene Name TEX261
Gene Alias MGC32043|TEG-261
Gene Description testis expressed 261
Storage Conditions Store at 4C. For long term storage store at -20C.
Aliquot to avoid repeated freezing and thawing.
Application Key WB-Ce,WB,IHC-P
Immunogen Prot. Seq NVLPSTMQPGDDVVSNYFTKGKRGKRLGILVVFSFIKEAILPSRQKIY
Form Liquid
Recomended Dilution Immunohistochemistry (1:20-1:50)
Western Blot (1:250-1:500)
The optimal working dilution should be determined by the end user.
Antigen species Target species Human
Immunogen Recombinant protein corresponding to amino acids of human TEX261.
Storage Buffer In PBS, pH 7.2 (40% glycerol, 0.02% sodium azide)
Gene ID 113419
Iso type IgG

Enviar un mensaje


TEX261 polyclonal antibody

TEX261 polyclonal antibody