TRIP4 polyclonal antibody
  • TRIP4 polyclonal antibody

TRIP4 polyclonal antibody

Ref: AB-PAB20890
TRIP4 polyclonal antibody

Información del producto

Rabbit polyclonal antibody raised against recombinant TRIP4.
Información adicional
Size 100 uL
Gene Name TRIP4
Gene Alias HsT17391
Gene Description thyroid hormone receptor interactor 4
Storage Conditions Store at 4C. For long term storage store at -20C.
Aliquot to avoid repeated freezing and thawing.
Application Key WB-Ce,WB,IHC-P
Immunogen Prot. Seq ILQRDSNKSQKLLKKLMSGVENSGKVDISTKDLLPHQELRIKSGLEKAIKHKDKLLEFDRTSIRRTQVIDDESDYFASDSNQWLSKLERETLQKREEELRELRHASRLSKKVTIDFAGRKILEEENSLA
Form Liquid
Recomended Dilution Immunohistochemistry (1:50-1:200)
Western Blot (1:250-1:500)
The optimal working dilution should be determined by the end user.
Antigen species Target species Human
Immunogen Recombinant protein corresponding to amino acids of human TRIP4.
Storage Buffer In PBS, pH 7.2 (40% glycerol, 0.02% sodium azide)
Gene ID 9325
Iso type IgG

Enviar un mensaje


TRIP4 polyclonal antibody

TRIP4 polyclonal antibody