C7orf42 polyclonal antibody
  • C7orf42 polyclonal antibody

C7orf42 polyclonal antibody

Ref: AB-PAB20878
C7orf42 polyclonal antibody

Información del producto

Rabbit polyclonal antibody raised against recombinant C7orf42.
Información adicional
Size 100 uL
Gene Name C7orf42
Gene Alias FLJ10099|FLJ13090
Gene Description chromosome 7 open reading frame 42
Storage Conditions Store at 4ºC. For long term storage store at -20ºC.
Aliquot to avoid repeated freezing and thawing.
Application Key IHC-P
Immunogen Prot. Seq GLSGREAHEEINITFTLPTAWSSDDCALHGHCEQVVFTACMTLTASPGVFPVTVQPPHCVPDTYSNATLWYKIFTTARDANTKYAQDYNPF
Form Liquid
Recomended Dilution Immunohistochemistry (1:20-1:50)
The optimal working dilution should be determined by the end user.
Antigen species Target species Human
Immunogen Recombinant protein corresponding to amino acids of human C7orf42.
Storage Buffer In PBS, pH 7.2 (40% glycerol, 0.02% sodium azide)
Gene ID 55069
Iso type IgG

Enviar un mensaje


C7orf42 polyclonal antibody

C7orf42 polyclonal antibody