FAM134C polyclonal antibody
  • FAM134C polyclonal antibody

FAM134C polyclonal antibody

Ref: AB-PAB20876
FAM134C polyclonal antibody

Información del producto

Rabbit polyclonal antibody raised against recombinant FAM134C.
Información adicional
Size 100 uL
Gene Name FAM134C
Gene Alias FLJ33806
Gene Description family with sequence similarity 134, member C
Storage Conditions Store at 4C. For long term storage store at -20C.
Aliquot to avoid repeated freezing and thawing.
Application Key WB,IHC-P
Immunogen Prot. Seq DFPSINMDPAGLDDEDDTSIGMPSLMYRSPPGAEEPQAPPASRDEAALPELLLGALPVGSNLTSNLASLVSQGMIQLALSGASQPGPSGAPAQRATRGFLRSPSSDLDTDAEGDDFELLDQSE
Form Liquid
Recomended Dilution Immunohistochemistry (1:50-1:200)
Western Blot (1:250-1:500)
The optimal working dilution should be determined by the end user.
Antigen species Target species Human
Immunogen Recombinant protein corresponding to amino acids of human FAM134C.
Storage Buffer In PBS, pH 7.2 (40% glycerol, 0.02% sodium azide)
Gene ID 162427
Iso type IgG

Enviar un mensaje


FAM134C polyclonal antibody

FAM134C polyclonal antibody