PIGG polyclonal antibody
  • PIGG polyclonal antibody

PIGG polyclonal antibody

Ref: AB-PAB20864
PIGG polyclonal antibody

Información del producto

Rabbit polyclonal antibody raised against recombinant PIGG.
Información adicional
Size 100 uL
Gene Name PIGG
Gene Alias DKFZp434A1810|DKFZp434C1712|DKFZp434M1131|FLJ20265|FLJ39925|GPI7|LAS21|MGC131903|PRO4405|RLGS1930
Gene Description phosphatidylinositol glycan anchor biosynthesis, class G
Storage Conditions Store at 4C. For long term storage store at -20C.
Aliquot to avoid repeated freezing and thawing.
Application Key IHC-P
Immunogen Prot. Seq VEYDGTTSFFVSDYTEVDNNVTRHLDKVLKRGDWDILILHYLGLDHIGHISGPNSPLIGQKLSEMDSVLMKIHTSLQSKERETPLPNLLVLCGDHGMSETGSHGASSTEEVNTPLILISSAFERKPGDIRHPKHVQQTDVA
Form Liquid
Recomended Dilution Immunohistochemistry (1:200-1:500)
The optimal working dilution should be determined by the end user.
Antigen species Target species Human
Immunogen Recombinant protein corresponding to amino acids of human PIGG.
Storage Buffer In PBS, pH 7.2 (40% glycerol, 0.02% sodium azide)
Gene ID 54872
Iso type IgG

Enviar un mensaje


PIGG polyclonal antibody

PIGG polyclonal antibody