IFFO2 polyclonal antibody
  • IFFO2 polyclonal antibody

IFFO2 polyclonal antibody

Ref: AB-PAB20861
IFFO2 polyclonal antibody

Información del producto

Rabbit polyclonal antibody raised against recombinant IFFO2.
Información adicional
Size 100 uL
Gene Name IFFO2
Gene Alias -
Gene Description intermediate filament family orphan 2
Storage Conditions Store at 4C. For long term storage store at -20C.
Aliquot to avoid repeated freezing and thawing.
Application Key WB,IHC-P
Immunogen Prot. Seq KVASDDDISEQDGEVNRFSDDEVGSMNITDEMKRMFNQLRETFDFDDDCDSLTWEENEDTLLLWEDFTNCNPTIDLQGEQEENLGNLIHETESFFKTRDKEYQET
Form Liquid
Recomended Dilution Immunohistochemistry (1:20-1:50)
Western Blot (1:250-1:500)
The optimal working dilution should be determined by the end user.
Antigen species Target species Human
Immunogen Recombinant protein corresponding to amino acids of human IFFO2.
Storage Buffer In PBS, pH 7.2 (40% glycerol, 0.02% sodium azide)
Gene ID 126917
Iso type IgG

Enviar un mensaje


IFFO2 polyclonal antibody

IFFO2 polyclonal antibody