PIEZO2 polyclonal antibody
  • PIEZO2 polyclonal antibody

PIEZO2 polyclonal antibody

Ref: AB-PAB20860
PIEZO2 polyclonal antibody

Información del producto

Rabbit polyclonal antibody raised against recombinant PIEZO2.
Información adicional
Size 100 uL
Gene Name PIEZO2
Gene Alias C18orf30|C18orf58|FAM38B|FAM38B2|HsT748|HsT771
Gene Description piezo-type mechanosensitive ion channel component 2
Storage Conditions Store at 4C. For long term storage store at -20C.
Aliquot to avoid repeated freezing and thawing.
Application Key WB,IHC-P
Immunogen Prot. Seq ESEKPIFTMSAQQSQLKVMDQQSFNKFIQAFSRDTGAMQFLENYEKEDITVAELEGNSNSLWTISPPSKQKMIHELLDPNSSFSVVFSWSIQRNLSLGAKSEIATDKLSFPLKNITRKNIAKM
Form Liquid
Recomended Dilution Immunohistochemistry (1:50-1:200)
Western Blot (1:250-1:500)
The optimal working dilution should be determined by the end user.
Antigen species Target species Human
Immunogen Recombinant protein corresponding to amino acids of human PIEZO2.
Storage Buffer In PBS, pH 7.2 (40% glycerol, 0.02% sodium azide)
Gene ID 63895
Iso type IgG

Enviar un mensaje


PIEZO2 polyclonal antibody

PIEZO2 polyclonal antibody