MTCH1 polyclonal antibody
  • MTCH1 polyclonal antibody

MTCH1 polyclonal antibody

Ref: AB-PAB20858
MTCH1 polyclonal antibody

Información del producto

Rabbit polyclonal antibody raised against recombinant MTCH1.
Información adicional
Size 100 uL
Gene Name MTCH1
Gene Alias CGI-64|MGC131998|PIG60|PSAP
Gene Description mitochondrial carrier homolog 1 (C. elegans)
Storage Conditions Store at 4C. For long term storage store at -20C.
Aliquot to avoid repeated freezing and thawing.
Application Key IHC-P
Immunogen Prot. Seq NLLAHFINAYLVDDSVSDTPGGLGNDQNPGSQFSQALAIRSYTK
Form Liquid
Recomended Dilution Immunohistochemistry (1:10-1:20)
The optimal working dilution should be determined by the end user.
Antigen species Target species Human
Immunogen Recombinant protein corresponding to amino acids of human MTCH1.
Storage Buffer In PBS, pH 7.2 (40% glycerol, 0.02% sodium azide)
Gene ID 23787
Iso type IgG

Enviar un mensaje


MTCH1 polyclonal antibody

MTCH1 polyclonal antibody