CISD2 polyclonal antibody
  • CISD2 polyclonal antibody

CISD2 polyclonal antibody

Ref: AB-PAB20855
CISD2 polyclonal antibody

Información del producto

Rabbit polyclonal antibody raised against recombinant CISD2.
Información adicional
Size 100 uL
Gene Name CISD2
Gene Alias ERIS|Miner1|WFS2|ZCD2
Gene Description CDGSH iron sulfur domain 2
Storage Conditions Store at 4C. For long term storage store at -20C.
Aliquot to avoid repeated freezing and thawing.
Application Key IHC-P,IF
Immunogen Prot. Seq PKKKQQKDSLINLKIQKENPKVVNEINIEDLCLTKAAYCRCWRSKTFPACDGSHNKHNELTGDNVGPLILKKKEV
Form Liquid
Recomended Dilution Immunohistochemistry (1:50-1:200)
Immunofluorescence (1-4 ug/mL)
The optimal working dilution should be determined by the end user.
Antigen species Target species Human
Immunogen Recombinant protein corresponding to amino acids of human CISD2.
Storage Buffer In PBS, pH 7.2 (40% glycerol, 0.02% sodium azide)
Gene ID 493856
Iso type IgG

Enviar un mensaje


CISD2 polyclonal antibody

CISD2 polyclonal antibody