ZNF330 polyclonal antibody
  • ZNF330 polyclonal antibody

ZNF330 polyclonal antibody

Ref: AB-PAB20837
ZNF330 polyclonal antibody

Información del producto

Rabbit polyclonal antibody raised against recombinant ZNF330.
Información adicional
Size 100 uL
Gene Name ZNF330
Gene Alias HSA6591|NOA36
Gene Description zinc finger protein 330
Storage Conditions Store at 4C. For long term storage store at -20C.
Aliquot to avoid repeated freezing and thawing.
Application Key WB,IHC-P
Immunogen Prot. Seq SCQVLEAETFKCVSCNRLGQHSCLRCKACFCDDHTRSKVFKQEKGKQPPCPKCGHETQETKDLSMSTRSLKFGRQTGGEEGDGASGYDAYWKNLSSDKYGDTSYHD
Form Liquid
Recomended Dilution Immunohistochemistry (1:50-1:200)
Western Blot (1:250-1:500)
The optimal working dilution should be determined by the end user.
Antigen species Target species Human
Immunogen Recombinant protein corresponding to amino acids of human ZNF330.
Storage Buffer In PBS, pH 7.2 (40% glycerol, 0.02% sodium azide)
Gene ID 27309
Iso type IgG

Enviar un mensaje


ZNF330 polyclonal antibody

ZNF330 polyclonal antibody