CD163L1 polyclonal antibody
  • CD163L1 polyclonal antibody

CD163L1 polyclonal antibody

Ref: AB-PAB20835
CD163L1 polyclonal antibody

Información del producto

Rabbit polyclonal antibody raised against recombinant CD163L1.
Información adicional
Size 100 uL
Gene Name CD163L1
Gene Alias CD163B|M160
Gene Description CD163 molecule-like 1
Storage Conditions Store at 4C. For long term storage store at -20C.
Aliquot to avoid repeated freezing and thawing.
Application Key IHC-P
Immunogen Prot. Seq LRVSTRRRGSLEENLFHEMETCLKREDPHGTRTSDDTPNHGCEDASDTSLLGVLPASEAT
Form Liquid
Recomended Dilution Immunohistochemistry (1:200-1:500)
The optimal working dilution should be determined by the end user.
Antigen species Target species Human
Immunogen Recombinant protein corresponding to amino acids of human CD163L1.
Storage Buffer In PBS, pH 7.2 (40% glycerol, 0.02% sodium azide)
Gene ID 283316
Iso type IgG

Enviar un mensaje


CD163L1 polyclonal antibody

CD163L1 polyclonal antibody