HSPA12B polyclonal antibody
  • HSPA12B polyclonal antibody

HSPA12B polyclonal antibody

Ref: AB-PAB20831
HSPA12B polyclonal antibody

Información del producto

Rabbit polyclonal antibody raised against recombinant HSPA12B.
Información adicional
Size 100 uL
Gene Name HSPA12B
Gene Alias C20orf60|FLJ32150|MGC131912|dJ1009E24.2
Gene Description heat shock 70kD protein 12B
Storage Conditions Store at 4C. For long term storage store at -20C.
Aliquot to avoid repeated freezing and thawing.
Application Key IHC-P
Immunogen Prot. Seq LAVPEMGLQGLYIGSSPERSPVPSPPGSPRTQESCGIAPLTPSQSPKPEVRAPQQASFSVVVAIDFGTTSSGYAFSFASDPEAIHMMRKWEGG
Form Liquid
Recomended Dilution Immunohistochemistry (1:20-1:50)
The optimal working dilution should be determined by the end user.
Antigen species Target species Human
Immunogen Recombinant protein corresponding to amino acids of human HSPA12B.
Storage Buffer In PBS, pH 7.2 (40% glycerol, 0.02% sodium azide)
Gene ID 116835
Iso type IgG

Enviar un mensaje


HSPA12B polyclonal antibody

HSPA12B polyclonal antibody