KIAA0319 polyclonal antibody
  • KIAA0319 polyclonal antibody

KIAA0319 polyclonal antibody

Ref: AB-PAB20824
KIAA0319 polyclonal antibody

Información del producto

Rabbit polyclonal antibody raised against recombinant KIAA0319.
Información adicional
Size 100 uL
Gene Name KIAA0319
Gene Alias DLX2|DYLX2|DYX2|MGC176717
Gene Description KIAA0319
Storage Conditions Store at 4C. For long term storage store at -20C.
Aliquot to avoid repeated freezing and thawing.
Application Key IHC-P
Immunogen Prot. Seq GRTYSNAVISPNLETTRIMRVSHTFPVVDCTAACCDLSSCDLAWWFEGRCYLVSCPHKENCEPKKMGPIRSYLTFVLRPVQRPAQLLDYGDMMLNRGSPSGIWGDSPEDIRKDLPFLGKDWGLEEMSEYSDDYRELEKDLLQPSG
Form Liquid
Recomended Dilution Immunohistochemistry (1:200-1:500)
The optimal working dilution should be determined by the end user.
Antigen species Target species Human
Immunogen Recombinant protein corresponding to amino acids of human KIAA0319.
Storage Buffer In PBS, pH 7.2 (40% glycerol, 0.02% sodium azide)
Gene ID 9856
Iso type IgG

Enviar un mensaje


KIAA0319 polyclonal antibody

KIAA0319 polyclonal antibody