PLCE1 polyclonal antibody
  • PLCE1 polyclonal antibody

PLCE1 polyclonal antibody

Ref: AB-PAB20820
PLCE1 polyclonal antibody

Información del producto

Rabbit polyclonal antibody raised against recombinant PLCE1.
Información adicional
Size 100 uL
Gene Name PLCE1
Gene Alias FLJ23659|KIAA1516|MGC167842|NPHS3|PLCE
Gene Description phospholipase C, epsilon 1
Storage Conditions Store at 4C. For long term storage store at -20C.
Aliquot to avoid repeated freezing and thawing.
Application Key IHC-P
Immunogen Prot. Seq MGISPLGNQSVIIETGRAHPDSRRAVFHFHYEVDRRMSDTFCTLSENLILDDCGNCVPLPGGEEKQKKNYVAYTCKLMELAKNCDNKNEQLQCDHCDTLNDKYFCFEGSCEKVDMVYSGDSFCRKDFTDSQAAKT
Form Liquid
Recomended Dilution Immunohistochemistry (1:50-1:200)
The optimal working dilution should be determined by the end user.
Antigen species Target species Human
Immunogen Recombinant protein corresponding to amino acids of human PLCE1.
Storage Buffer In PBS, pH 7.2 (40% glycerol, 0.02% sodium azide)
Gene ID 51196
Iso type IgG

Enviar un mensaje


PLCE1 polyclonal antibody

PLCE1 polyclonal antibody