NSRP1 polyclonal antibody
  • NSRP1 polyclonal antibody

NSRP1 polyclonal antibody

Ref: AB-PAB20819
NSRP1 polyclonal antibody

Información del producto

Rabbit polyclonal antibody raised against recombinant NSRP1.
Información adicional
Size 100 uL
Gene Name NSRP1
Gene Alias CCDC55|HSPC095|NSrp70
Gene Description nuclear speckle splicing regulatory protein 1
Storage Conditions Store at 4C. For long term storage store at -20C.
Aliquot to avoid repeated freezing and thawing.
Application Key WB,IHC-P
Immunogen Prot. Seq KREVGVQSSERNQDRKESSPNSRAKDKFLDQERSNKMRNMAKDKERNQEKPSNSESSLGAKHRLTEEGQEKGKEQERPPEAVSKFAKRNNEETVM
Form Liquid
Recomended Dilution Immunohistochemistry (1:500-1:1000)
Western Blot (1:250-1:500)
The optimal working dilution should be determined by the end user.
Antigen species Target species Human
Immunogen Recombinant protein corresponding to amino acids of human NSRP1.
Storage Buffer In PBS, pH 7.2 (40% glycerol, 0.02% sodium azide)
Gene ID 84081
Iso type IgG

Enviar un mensaje


NSRP1 polyclonal antibody

NSRP1 polyclonal antibody