TXNDC15 polyclonal antibody
  • TXNDC15 polyclonal antibody

TXNDC15 polyclonal antibody

Ref: AB-PAB20811
TXNDC15 polyclonal antibody

Información del producto

Rabbit polyclonal antibody raised against recombinant TXNDC15.
Información adicional
Size 100 uL
Gene Name TXNDC15
Gene Alias C5orf14|FLJ22625|UNQ335
Gene Description thioredoxin domain containing 15
Storage Conditions Store at 4C. For long term storage store at -20C.
Aliquot to avoid repeated freezing and thawing.
Application Key IHC-P
Immunogen Prot. Seq TGLENFTLKILNMSQDLMDFLNPNGSDCTLVLFYTPWCRFSASLAPHFNSLPRAFPALHFLALDASQHSSLSTRFGTVAVPNILLFQGAKPMARFNHTDRTLETLKIFIFNQTGIEAKKNVVVTQADQI
Form Liquid
Recomended Dilution Immunohistochemistry (1:10-1:20)
The optimal working dilution should be determined by the end user.
Antigen species Target species Human
Immunogen Recombinant protein corresponding to amino acids of human TXNDC15.
Storage Buffer In PBS, pH 7.2 (40% glycerol, 0.02% sodium azide)
Gene ID 79770
Iso type IgG

Enviar un mensaje


TXNDC15 polyclonal antibody

TXNDC15 polyclonal antibody