ERGIC3 polyclonal antibody
  • ERGIC3 polyclonal antibody

ERGIC3 polyclonal antibody

Ref: AB-PAB20802
ERGIC3 polyclonal antibody

Información del producto

Rabbit polyclonal antibody raised against recombinant ERGIC3.
Información adicional
Size 100 uL
Gene Name ERGIC3
Gene Alias C20orf47|CGI-54|Erv46|NY-BR-84|PRO0989|SDBCAG84|dJ477O4.2
Gene Description ERGIC and golgi 3
Storage Conditions Store at 4C. For long term storage store at -20C.
Aliquot to avoid repeated freezing and thawing.
Application Key WB,IHC-P
Immunogen Prot. Seq CNTCEDVREAYRRRGWAFKNPDTIEQCRREGFSQKMQEQKNEGCQVYGFLEVNKVAGNFHFAPGKSFQQSHVH
Form Liquid
Recomended Dilution Immunohistochemistry (1:20-1:50)
Western Blot (1:250-1:500)
The optimal working dilution should be determined by the end user.
Antigen species Target species Human
Immunogen Recombinant protein corresponding to amino acids of human ERGIC3.
Storage Buffer In PBS, pH 7.2 (40% glycerol, 0.02% sodium azide)
Gene ID 51614
Iso type IgG

Enviar un mensaje


ERGIC3 polyclonal antibody

ERGIC3 polyclonal antibody