SLC41A1 polyclonal antibody
  • SLC41A1 polyclonal antibody

SLC41A1 polyclonal antibody

Ref: AB-PAB20800
SLC41A1 polyclonal antibody

Información del producto

Rabbit polyclonal antibody raised against recombinant SLC41A1.
Información adicional
Size 100 uL
Gene Name SLC41A1
Gene Alias MgtE
Gene Description solute carrier family 41, member 1
Storage Conditions Store at 4C. For long term storage store at -20C.
Aliquot to avoid repeated freezing and thawing.
Application Key WB,IHC-P
Immunogen Prot. Seq QASRISTFLHMNGMPGENSEQAPRRCPSPCTTFFSPDVNSRSAR
Form Liquid
Recomended Dilution Immunohistochemistry (1:50-1:200)
Western Blot (1:250-1:500)
The optimal working dilution should be determined by the end user.
Antigen species Target species Human
Immunogen Recombinant protein corresponding to amino acids of human SLC41A1.
Storage Buffer In PBS, pH 7.2 (40% glycerol, 0.02% sodium azide)
Gene ID 254428
Iso type IgG

Enviar un mensaje


SLC41A1 polyclonal antibody

SLC41A1 polyclonal antibody