LRRC37B polyclonal antibody
  • LRRC37B polyclonal antibody

LRRC37B polyclonal antibody

Ref: AB-PAB20799
LRRC37B polyclonal antibody

Información del producto

Rabbit polyclonal antibody raised against recombinant LRRC37B.
Información adicional
Size 100 uL
Gene Name LRRC37B
Gene Alias -
Gene Description leucine rich repeat containing 37B
Storage Conditions Store at 4C. For long term storage store at -20C.
Aliquot to avoid repeated freezing and thawing.
Application Key IHC-P,IF
Immunogen Prot. Seq PFLAAHQDLNDKRTPEERLPEVVPLLNRDQNQALVQLPRLKWVQTTDLDRAAGHQADEILVPLDSKVSRPTKFVVSPKNLKKDLAERWSLPEIVGIPH
Form Liquid
Recomended Dilution Immunohistochemistry (1:50-1:200)
Immunofluorescence (1-4 ug/mL)
The optimal working dilution should be determined by the end user.
Antigen species Target species Human
Immunogen Recombinant protein corresponding to amino acids of human LRRC37B.
Storage Buffer In PBS, pH 7.2 (40% glycerol, 0.02% sodium azide)
Gene ID 114659
Iso type IgG

Enviar un mensaje


LRRC37B polyclonal antibody

LRRC37B polyclonal antibody