DENND4C polyclonal antibody
  • DENND4C polyclonal antibody

DENND4C polyclonal antibody

Ref: AB-PAB20794
DENND4C polyclonal antibody

Información del producto

Rabbit polyclonal antibody raised against recombinant DENND4C.
Información adicional
Size 100 uL
Gene Name DENND4C
Gene Alias C9orf55|C9orf55B|DKFZp686I09113|FLJ20686|bA513M16.3
Gene Description DENN/MADD domain containing 4C
Storage Conditions Store at 4C. For long term storage store at -20C.
Aliquot to avoid repeated freezing and thawing.
Application Key WB,IHC-P
Immunogen Prot. Seq ETNRDYSFPAGLEDHILGENISPNTSISGLVPSELTQSNTSLGSSSSSGDVGKLHYPTGEVPFPRGMKGQDFEKSDHGSSQNTSMSSIYQNCAMEVLMSSCSQCRACGALVYDEEIMA
Form Liquid
Recomended Dilution Immunohistochemistry (1:20-1:50)
Western Blot (1:250-1:500)
The optimal working dilution should be determined by the end user.
Antigen species Target species Human
Immunogen Recombinant protein corresponding to amino acids of human DENND4C.
Storage Buffer In PBS, pH 7.2 (40% glycerol, 0.02% sodium azide)
Gene ID 55667
Iso type IgG

Enviar un mensaje


DENND4C polyclonal antibody

DENND4C polyclonal antibody