CYP2C9 polyclonal antibody
  • CYP2C9 polyclonal antibody

CYP2C9 polyclonal antibody

Ref: AB-PAB20791
CYP2C9 polyclonal antibody

Información del producto

Rabbit polyclonal antibody raised against recombinant CYP2C9.
Información adicional
Size 100 uL
Gene Name CYP2C9
Gene Alias CPC9|CYP2C|CYP2C10|MGC149605|MGC88320|P450IIC9
Gene Description cytochrome P450, family 2, subfamily C, polypeptide 9
Storage Conditions Store at 4C. For long term storage store at -20C.
Aliquot to avoid repeated freezing and thawing.
Application Key WB,IHC-P
Immunogen Prot. Seq KEHQESMDINNPRDFIDCFLIKMEKEKQNQQSEFTIENLVITAADLLGAGTETTST
Form Liquid
Recomended Dilution Immunohistochemistry (1:200-1:500)
Western Blot (0.04-0.4 ug/mL)
The optimal working dilution should be determined by the end user.
Antigen species Target species Human
Immunogen Recombinant protein corresponding to amino acids of human CYP2C9.
Storage Buffer In PBS, pH 7.2 (40% glycerol, 0.02% sodium azide).
Gene ID 1559
Iso type IgG

Enviar un mensaje


CYP2C9 polyclonal antibody

CYP2C9 polyclonal antibody