GJC3 polyclonal antibody
  • GJC3 polyclonal antibody

GJC3 polyclonal antibody

Ref: AB-PAB20786
GJC3 polyclonal antibody

Información del producto

Rabbit polyclonal antibody raised against recombinant GJC3.
Información adicional
Size 100 uL
Gene Name GJC3
Gene Alias CX30.2|CX31.3|Cx29|GJE1
Gene Description gap junction protein, gamma 3, 30.2kDa
Storage Conditions Store at 4C. For long term storage store at -20C.
Aliquot to avoid repeated freezing and thawing.
Application Key IHC-P
Immunogen Prot. Seq RTWKHKSSSSKYFLTSESTRRHKKATDSLPVVETKEQFQEAVPGRSLAQEKQRPVGPRDA
Form Liquid
Recomended Dilution Immunohistochemistry (1:20-1:50)
The optimal working dilution should be determined by the end user.
Antigen species Target species Human
Immunogen Recombinant protein corresponding to amino acids of human GJC3.
Storage Buffer In PBS, pH 7.2 (40% glycerol, 0.02% sodium azide)
Gene ID 349149
Iso type IgG

Enviar un mensaje


GJC3 polyclonal antibody

GJC3 polyclonal antibody