TMEM41B polyclonal antibody
  • TMEM41B polyclonal antibody

TMEM41B polyclonal antibody

Ref: AB-PAB20785
TMEM41B polyclonal antibody

Información del producto

Rabbit polyclonal antibody raised against recombinant TMEM41B.
Información adicional
Size 100 uL
Gene Name TMEM41B
Gene Alias KIAA0033|MGC33897|MGC57262
Gene Description transmembrane protein 41B
Storage Conditions Store at 4C. For long term storage store at -20C.
Aliquot to avoid repeated freezing and thawing.
Application Key WB-Tr,IHC-P
Immunogen Prot. Seq MAKGRVAERSQLGAHHTTPVGDGAAGTRGLAAPGSRDHQKEKSWVEAGS
Form Liquid
Recomended Dilution Immunohistochemistry (1:20-1:50)
The optimal working dilution should be determined by the end user.
Antigen species Target species Human
Immunogen Recombinant protein corresponding to amino acids of human TMEM41B.
Storage Buffer In PBS, pH 7.2 (40% glycerol, 0.02% sodium azide)
Gene ID 440026
Iso type IgG

Enviar un mensaje


TMEM41B polyclonal antibody

TMEM41B polyclonal antibody