SSR3 polyclonal antibody
  • SSR3 polyclonal antibody

SSR3 polyclonal antibody

Ref: AB-PAB20781
SSR3 polyclonal antibody

Información del producto

Rabbit polyclonal antibody raised against recombinant SSR3.
Información adicional
Size 100 uL
Gene Name SSR3
Gene Alias TRAPG
Gene Description signal sequence receptor, gamma (translocon-associated protein gamma)
Storage Conditions Store at 4C. For long term storage store at -20C.
Aliquot to avoid repeated freezing and thawing.
Application Key WB-Ce,WB,IHC-P
Immunogen Prot. Seq VLKHKVAQKREDAVSKEVTRKLSEADNRKMSRKEKDERILWKKNEVADYEA
Form Liquid
Recomended Dilution Immunohistochemistry (1:200-1:500)
Western Blot (1:250-1:500)
The optimal working dilution should be determined by the end user.
Antigen species Target species Human
Immunogen Recombinant protein corresponding to amino acids of human SSR3.
Storage Buffer In PBS, pH 7.2 (40% glycerol, 0.02% sodium azide)
Gene ID 6747
Iso type IgG

Enviar un mensaje


SSR3 polyclonal antibody

SSR3 polyclonal antibody