SLC31A2 polyclonal antibody
  • SLC31A2 polyclonal antibody

SLC31A2 polyclonal antibody

Ref: AB-PAB20777
SLC31A2 polyclonal antibody

Información del producto

Rabbit polyclonal antibody raised against recombinant SLC31A2.
Información adicional
Size 100 uL
Gene Name SLC31A2
Gene Alias COPT2|CTR2|hCTR2
Gene Description solute carrier family 31 (copper transporters), member 2
Storage Conditions Store at 4C. For long term storage store at -20C.
Aliquot to avoid repeated freezing and thawing.
Application Key IHC-P
Immunogen Prot. Seq YEGIKVGKAKLLNQVLVNLPTSISQQTIAETDGDSAGSDSFPVGRTHHRWYLC
Form Liquid
Recomended Dilution Immunohistochemistry (1:20-1:50)
The optimal working dilution should be determined by the end user.
Antigen species Target species Human
Immunogen Recombinant protein corresponding to amino acids of human SLC31A2.
Storage Buffer In PBS, pH 7.2 (40% glycerol, 0.02% sodium azide)
Gene ID 1318
Iso type IgG

Enviar un mensaje


SLC31A2 polyclonal antibody

SLC31A2 polyclonal antibody