YIPF3 polyclonal antibody
  • YIPF3 polyclonal antibody

YIPF3 polyclonal antibody

Ref: AB-PAB20776
YIPF3 polyclonal antibody

Información del producto

Rabbit polyclonal antibody raised against recombinant YIPF3.
Información adicional
Size 100 uL
Gene Name YIPF3
Gene Alias C6orf109|DKFZp566C243|FinGER3|KLIP1|dJ337H4.3
Gene Description Yip1 domain family, member 3
Storage Conditions Store at 4C. For long term storage store at -20C.
Aliquot to avoid repeated freezing and thawing.
Application Key WB-Tr,IHC-P,IF
Immunogen Prot. Seq GILDTLEGPNIPPIQRVPRDIPAMLPAARLPTTVLNATAKAVAVTLQSH
Form Liquid
Recomended Dilution Immunohistochemistry (1:10-1:20)
Western Blot (1:250-1:500)
Immunofluorescence (1-4 ug/mL)
The optimal working dilution should be determined by the end user.
Antigen species Target species Human
Immunogen Recombinant protein corresponding to amino acids of human YIPF3.
Storage Buffer In PBS, pH 7.2 (40% glycerol, 0.02% sodium azide)
Gene ID 25844
Iso type IgG

Enviar un mensaje


YIPF3 polyclonal antibody

YIPF3 polyclonal antibody