KCNE3 polyclonal antibody
  • KCNE3 polyclonal antibody

KCNE3 polyclonal antibody

Ref: AB-PAB20775
KCNE3 polyclonal antibody

Información del producto

Rabbit polyclonal antibody raised against recombinant KCNE3.
Información adicional
Size 100 uL
Gene Name KCNE3
Gene Alias DKFZp781H21101|HOKPP|MGC102685|MGC129924|MiRP2
Gene Description potassium voltage-gated channel, Isk-related family, member 3
Storage Conditions Store at 4C. For long term storage store at -20C.
Aliquot to avoid repeated freezing and thawing.
Application Key IHC-P
Immunogen Prot. Seq METTNGTETWYESLHAVLKALNATLHSNLLCRPGPGLGPDNQTEERRASLPGRDDN
Form Liquid
Recomended Dilution Immunohistochemistry (1:500-1:1000)
The optimal working dilution should be determined by the end user.
Antigen species Target species Human
Immunogen Recombinant protein corresponding to amino acids of human KCNE3.
Storage Buffer In PBS, pH 7.2 (40% glycerol, 0.02% sodium azide)
Gene ID 10008
Iso type IgG

Enviar un mensaje


KCNE3 polyclonal antibody

KCNE3 polyclonal antibody