KIDINS220 polyclonal antibody
  • KIDINS220 polyclonal antibody

KIDINS220 polyclonal antibody

Ref: AB-PAB20769
KIDINS220 polyclonal antibody

Información del producto

Rabbit polyclonal antibody raised against recombinant KIDINS220.
Información adicional
Size 100 uL
Gene Name KIDINS220
Gene Alias ARMS|MGC163482
Gene Description kinase D-interacting substrate, 220kDa
Storage Conditions Store at 4C. For long term storage store at -20C.
Aliquot to avoid repeated freezing and thawing.
Application Key IHC-P
Immunogen Prot. Seq EPLLEIDGDIRNFEVFLSSRTPVLVARDVKVFLPCTVNLDPKLREIIADVRAAREQISIGGLAYPPLPLHEGPPRAPSGYSQPPSVCSSTSFNGPFAGGVVS
Form Liquid
Recomended Dilution Immunohistochemistry (1:20-1:50)
The optimal working dilution should be determined by the end user.
Antigen species Target species Human
Immunogen Recombinant protein corresponding to amino acids of human KIDINS220.
Storage Buffer In PBS, pH 7.2 (40% glycerol, 0.02% sodium azide)
Gene ID 57498
Iso type IgG

Enviar un mensaje


KIDINS220 polyclonal antibody

KIDINS220 polyclonal antibody