TMEM55A polyclonal antibody
  • TMEM55A polyclonal antibody

TMEM55A polyclonal antibody

Ref: AB-PAB20746
TMEM55A polyclonal antibody

Información del producto

Rabbit polyclonal antibody raised against recombinant TMEM55A.
Información adicional
Size 100 uL
Gene Name TMEM55A
Gene Alias DKFZp762O076
Gene Description transmembrane protein 55A
Storage Conditions Store at 4C. For long term storage store at -20C.
Aliquot to avoid repeated freezing and thawing.
Application Key IHC-P
Immunogen Prot. Seq PCNCLLICKDTSRRIGCPRPNCRRIINLGPVMLISEEQPAQPALPIQPEGTRVVCGHCGNTFLWMELRFNTLAKCPHCKKISSVGSA
Form Liquid
Recomended Dilution Immunohistochemistry (1:20-1:50)
The optimal working dilution should be determined by the end user.
Antigen species Target species Human
Immunogen Recombinant protein corresponding to amino acids of human TMEM55A.
Storage Buffer In PBS, pH 7.2 (40% glycerol, 0.02% sodium azide)
Gene ID 55529
Iso type IgG

Enviar un mensaje


TMEM55A polyclonal antibody

TMEM55A polyclonal antibody