KIAA0355 polyclonal antibody
  • KIAA0355 polyclonal antibody

KIAA0355 polyclonal antibody

Ref: AB-PAB20743
KIAA0355 polyclonal antibody

Información del producto

Rabbit polyclonal antibody raised against recombinant KIAA0355.
Información adicional
Size 100 uL
Gene Name KIAA0355
Gene Alias -
Gene Description KIAA0355
Storage Conditions Store at 4C. For long term storage store at -20C.
Aliquot to avoid repeated freezing and thawing.
Application Key WB-Ce,WB,IHC-P
Immunogen Prot. Seq GCYNGITSRDDFPVTEVLNQVCPSTWRGACKTAVQLLFGQAGLVVVDTAQIENKEAYAPQISLEGSRIVVQVPSTWCLKEDPATMSLLQRSLDPEKTLGLVDVL
Form Liquid
Recomended Dilution Immunohistochemistry (1:20-1:50)
Western Blot (1:250-1:500)
The optimal working dilution should be determined by the end user.
Antigen species Target species Human
Immunogen Recombinant protein corresponding to amino acids of human KIAA0355.
Storage Buffer In PBS, pH 7.2 (40% glycerol, 0.02% sodium azide)
Gene ID 9710
Iso type IgG

Enviar un mensaje


KIAA0355 polyclonal antibody

KIAA0355 polyclonal antibody