MGC3196 polyclonal antibody
  • MGC3196 polyclonal antibody

MGC3196 polyclonal antibody

Ref: AB-PAB20736
MGC3196 polyclonal antibody

Información del producto

Rabbit polyclonal antibody raised against recombinant MGC3196.
Información adicional
Size 100 uL
Gene Name MGC3196
Gene Alias -
Gene Description hypothetical protein MGC3196
Storage Conditions Store at 4C. For long term storage store at -20C.
Aliquot to avoid repeated freezing and thawing.
Application Key IHC-P
Immunogen Prot. Seq RSVRSVVLRAGGQQVTLTTHAPFGLGAHFTVPLKQVSCMAHRGEVPAMLPLKVKGRRFYFLLDKTGHFPNTKLFDNTVGAYRSL
Form Liquid
Recomended Dilution Immunohistochemistry (1:20-1:50)
The optimal working dilution should be determined by the end user.
Antigen species Target species Human
Immunogen Recombinant protein corresponding to amino acids of human MGC3196.
Storage Buffer In PBS, pH 7.2 (40% glycerol, 0.02% sodium azide)
Gene ID 79064
Iso type IgG

Enviar un mensaje


MGC3196 polyclonal antibody

MGC3196 polyclonal antibody