FZD10 polyclonal antibody
  • FZD10 polyclonal antibody

FZD10 polyclonal antibody

Ref: AB-PAB20734
FZD10 polyclonal antibody

Información del producto

Rabbit polyclonal antibody raised against recombinant FZD10.
Información adicional
Size 100 uL
Gene Name FZD10
Gene Alias CD350|FZ-10|FzE7|hFz10
Gene Description frizzled homolog 10 (Drosophila)
Storage Conditions Store at 4C. For long term storage store at -20C.
Aliquot to avoid repeated freezing and thawing.
Application Key IHC-P
Immunogen Prot. Seq KTLQSWQQVCSRRLKKKSRRKPASVITSGGIYKKAQHPQKTHHGKYEIPAQSPTCV
Form Liquid
Recomended Dilution Immunohistochemistry (1:10-1:20)
The optimal working dilution should be determined by the end user.
Antigen species Target species Human
Immunogen Recombinant protein corresponding to amino acids of human FZD10.
Storage Buffer In PBS, pH 7.2 (40% glycerol, 0.02% sodium azide)
Gene ID 11211
Iso type IgG

Enviar un mensaje


FZD10 polyclonal antibody

FZD10 polyclonal antibody