ZDHHC20 polyclonal antibody
  • ZDHHC20 polyclonal antibody

ZDHHC20 polyclonal antibody

Ref: AB-PAB20732
ZDHHC20 polyclonal antibody

Información del producto

Rabbit polyclonal antibody raised against recombinant ZDHHC20.
Información adicional
Size 100 uL
Gene Name ZDHHC20
Gene Alias FLJ25952|MGC126005
Gene Description zinc finger, DHHC-type containing 20
Storage Conditions Store at 4C. For long term storage store at -20C.
Aliquot to avoid repeated freezing and thawing.
Application Key IHC-P
Immunogen Prot. Seq SKEFYLSNSEKERYEKEFSQERQQEILRRAARALPIYTTSASKTIRYCEKCQLIKPDRAHHCSACDSCILKMDHHCPWVNNCV
Form Liquid
Recomended Dilution Immunohistochemistry (1:20-1:50)
The optimal working dilution should be determined by the end user.
Antigen species Target species Human
Immunogen Recombinant protein corresponding to amino acids of human ZDHHC20.
Storage Buffer In PBS, pH 7.2 (40% glycerol, 0.02% sodium azide)
Gene ID 253832
Iso type IgG

Enviar un mensaje


ZDHHC20 polyclonal antibody

ZDHHC20 polyclonal antibody