GSG1L polyclonal antibody
  • GSG1L polyclonal antibody

GSG1L polyclonal antibody

Ref: AB-PAB20730
GSG1L polyclonal antibody

Información del producto

Rabbit polyclonal antibody raised against recombinant GSG1L.
Información adicional
Size 100 uL
Gene Name GSG1L
Gene Alias MGC18079|PRO19651
Gene Description GSG1-like
Storage Conditions Store at 4C. For long term storage store at -20C.
Aliquot to avoid repeated freezing and thawing.
Application Key IHC-P
Immunogen Prot. Seq QGYREEPTFIDPEAIKYFRERMEKRDGSEEDFHLDCRHERYPARHQPHMADSWPRSSAQEAPELNRQCWVLGHWV
Form Liquid
Recomended Dilution Immunohistochemistry (1:50-1:200)
The optimal working dilution should be determined by the end user.
Antigen species Target species Human
Immunogen Recombinant protein corresponding to amino acids of human GSG1L.
Storage Buffer In PBS, pH 7.2 (40% glycerol, 0.02% sodium azide)
Gene ID 146395
Iso type IgG

Enviar un mensaje


GSG1L polyclonal antibody

GSG1L polyclonal antibody